PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.4A49L
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 285aa    MW: 32518.4 Da    PI: 7.4589
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.4A49LgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM145.72.5e-45181441128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                  + pGf+F Ptd el+++yL+kk++g++ ++ ++i+e++++++ePwdLp k++ ++++ew+fFs+r +ky+++++++ratksgyWk tgk++++ s ++
  Araip.4A49L  18 MFPGFKFCPTDGELISYYLRKKLDGDEDSV-QIISELELCTFEPWDLPeKSFIKSNDEWFFFSRRGRKYPNSSQNKRATKSGYWKVTGKERQIES-GQ 113
                  579************************999.89***************656656778*************************************9.99 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  +++g+++tLvf+ gr pkge+t+W++hey +
  Araip.4A49L 114 NVIGTRRTLVFHVGRVPKGERTEWIIHEYCI 144
                  9****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-4810150IPR003441NAC domain
PROSITE profilePS5100545.91918177IPR003441NAC domain
PfamPF023651.6E-2320143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MVDRDSSEAH MSIAASSMFP GFKFCPTDGE LISYYLRKKL DGDEDSVQII SELELCTFEP  60
WDLPEKSFIK SNDEWFFFSR RGRKYPNSSQ NKRATKSGYW KVTGKERQIE SGQNVIGTRR  120
TLVFHVGRVP KGERTEWIIH EYCINDKFQS SNQIRILWWF VGSRRTQNFI QMMILTKLHA  180
RVVVESQKGV TVQRSTCVPI QDKEVGCSSK RSNNSNSSPS ITVQIESSNR VANEVNPKAS  240
SNESSDRVAN EANPKASSNH SKVDEVDYYA EINLDDIINL DEPAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-381414211138Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016200447.11e-155PREDICTED: NAC domain-containing protein 40-like
TrEMBLA0A0B2RW701e-95A0A0B2RW70_GLYSO; NAC domain-containing protein 89
TrEMBLK7M2Z62e-96K7M2Z6_SOYBN; Uncharacterized protein
STRINGGLYMA13G39090.24e-96(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73153346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.14e-74NTM1-like 8